Customer service: Sequence MHKNDLINFSNFSQLDEYQLASVDGGFIPVAVWALWAGAGAAGFSGGIAVGLNRVNRNN,90% purity, 3 MG

https://www.pcr-pooling.com/web/image/product.template/6177/image_1920?unique=5bc509a

965.00 € 965.0 EUR 965.00 €

965.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days